PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G21580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 240aa    MW: 26494.3 Da    PI: 8.2338
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G21580.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF59.44.5e-191057249
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                  ri+n+  rqv fskRr+g +KKA+EL  LC+aeva+++ s+ g++y +
  OB06G21580.1 10 RIKNDEARQVCFSKRRAGAFKKASELYALCGAEVAMLVKSPAGNFYSF 57
                  8*********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.577161IPR002100Transcription factor, MADS-box
SMARTSM004322.4E-23160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-23175IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-16323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MTKRKIEIDR IKNDEARQVC FSKRRAGAFK KASELYALCG AEVAMLVKSP AGNFYSFGAP  60
SAGSVLTRFH AATTAGEHYS TLLGVGMHCD NSVTIALHEL NQQHVELQKQ LQAQNEKMKL  120
LQEAAKMESG GRVMCLLDSK VGDMSQEDLE EFSIVLGSVK GMIRGAINRL YQNYAMLSNA  180
MHVQHSVTTT PNQQFLLSGE DVKPMTHHVP SSSYGWNTMI DGKPNSCDAQ DVGIMRHFPK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642726.11e-126PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLJ3MDR40.0J3MDR4_ORYBR; Uncharacterized protein
STRINGOB06G21580.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP169561112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-21AGAMOUS-like 62